Anti-FAM105A

Code: av49425-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-FAM105A antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

<...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-FAM105A antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

FAM105A belongs to the FAM105 family. The exact function of FAM105A remains unknown.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

FAM105A is a deubiquitinase that is characterized by the presence of ovarian tumor (OTU) domain. It is observed to be overexpressed in human carcinoma cell line, A549.

Immunogen

Synthetic peptide directed towards the middle region of human FAM105A

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FAM105A(54491)
mol wt42 kDa
NCBI accession no.NP_061891
Quality Level100
shipped inwet ice
species reactivitymouse, horse, human, rabbit, guinea pig, rat, bovine, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NUU6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.