Not available outside of the UK & Ireland.
Application
Anti-FAM105A antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.
Biochem/physiol Actions
FAM105A belongs to the FAM105 family. The exact function of FAM105A remains unknown.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
FAM105A is a deubiquitinase that is characterized by the presence of ovarian tumor (OTU) domain. It is observed to be overexpressed in human carcinoma cell line, A549.
Immunogen
Synthetic peptide directed towards the middle region of human FAM105A
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFS
This product has met the following criteria to qualify for the following awards: