Anti-ZBTB7C

Code: AV32872-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-ZBTB7C antibody can be used for western blotting applications at a concentration of 5µg/ml.

Biochem/physiol Actions

...


 En savoir plus

Votre prix
$456.36 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-ZBTB7C antibody can be used for western blotting applications at a concentration of 5µg/ml.

Biochem/physiol Actions

The function of Anti-ZBTB7C has not yet been determined.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZBTB7C is a zinc-finger protein that functions as a tumor suppressor. Decreased ZBTB7C expression has been linked to cervical carcinoma.Rabbit Anti-ZBTB7C antibody recognizes rat, mouse, bovine, human, chicken, and canine ZBTB7C.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZBTB7C

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZBTB7C(201501)
mol wt69 kDa
NCBI accession no.NP_001034449
Quality Level100
shipped inwet ice
species reactivitygoat, mouse, rat, bovine, dog, guinea pig, horse, human, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O73453
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.