Not available outside of the UK & Ireland.
Application
Rabbit Anti-ZBTB7C antibody can be used for western blotting applications at a concentration of 5µg/ml.
Biochem/physiol Actions
The function of Anti-ZBTB7C has not yet been determined.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ZBTB7C is a zinc-finger protein that functions as a tumor suppressor. Decreased ZBTB7C expression has been linked to cervical carcinoma.Rabbit Anti-ZBTB7C antibody recognizes rat, mouse, bovine, human, chicken, and canine ZBTB7C.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZBTB7C
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS
This product has met the following criteria to qualify for the following awards: