SILu(TM) Prot IGFBP7 Insulin-like grow

Code: MSST0037-10UG D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

SILuProt IGFBP7 is a recombinant, stable isotope-labeled human IGFBP7 which incorporates [13C6, 15N...


 Read more

Your Price
$812.31 10UG

Not available outside of the UK & Ireland.

Biochem/physiol Actions

SILuProt IGFBP7 is a recombinant, stable isotope-labeled human IGFBP7 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IGFBP7 in mass-spectrometry. SILu Prot IGFBP7 is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa.

General description

IGFBP7 regulates the availability of insulin-like growth factors (IGFs) in tissue, and modulates IGF binding to its receptors. IGFBP7 binds to IGF with high affinity. Several studies have shown the involvement of IGFBP7 in Acute Kidney Injury (AKI), where its levels can predict patients at risk for developing AKI. When combined with TIMP-2, the accuracy of AKI risk prediction is further increased. Urinary [TIMP-2]×[IGFBP7] test sufficiently detects patients with risk of AKI after major non-cardiac surgery. In addition, Urinary [TIMP-2]×[IGFBP7] serves as a sensitive and specific biomarker to predict AKI early after cardiac surgery and to predict renal recovery.

Immunogen

HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

assay≥98% (SDS-PAGE)
biological sourcehuman
formlyophilized powder
Gene Informationhuman ... IGFBP7(3490)
potency≥98 Heavy amino acids incorporation efficiency by MS
Quality Level200
recombinantexpressed in HEK 293 cells
storage temp.−20°C
suitabilitysuitable for mass spectrometry (standard)
technique(s)mass spectrometry (MS): suitable
UniProt accession no.Q16270
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.