SILU(TM)MAB ADALIMUMAB STABLE-ISOTOPE

Code: MSQC11-100UG D2-231

Not available outside of the UK & Ireland.

Analysis Note

QuantitativeMRM settings provided (xls)

Application

Poster: Multiplex Quantification of Infliximab and Adalimumab ...


 Read more

Your Price
$510.21 100UG

Not available outside of the UK & Ireland.

Analysis Note

QuantitativeMRM settings provided (xls)

Application

Poster: Multiplex Quantification of Infliximab and Adalimumab in Human Serum by LC-MS/MS Using Full-Length Stable Isotope Labeled Internal Standards

General description

SILu MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4. SILu MAb Adalimumab is for R&D use only. Not for drug, household, or other uses.

Immunogen

SILuMab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGSILuMab Adalimumab Light Chain: DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].

Preparation Note

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.SILuMab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.

Reconstitution

Each vial of SILuMab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.

SILuMab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution. Briefly centrifuge the vial at ~10,000 × g to collect the product at the bottom of the vial. Add 500 µL of ultrapure water containing 0.1% formic acid to the vial. Mix the contents by gently inverting the vial a minimum of 5 times. Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.

Sequence

Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic DigestUniversal Peptide Sequence LocationGLEWVSAITWNSGHIDYADSVEGR Heavy chainAPYTFGQGTK Light chainFSGSGSGTDFTLTISSLQPEDVATYYCQR Light chain

antibody product typeprimary antibodies
assay≥90% (SDS-PAGE)
packagingvial of 100 µg
Quality Level200
recombinantexpressed in CHO cells
shipped inwet ice
storage temp.−20°C
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.