Interféron-GAMMA HUMAN

Code: i17001-100ug D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Analysis Note

The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of...


 En savoir plus

Votre prix
$471.17 100UG

Non disponible en dehors du Royaume-Uni et de l'Irlande

Analysis Note

The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay.

Application

Interferon-γ human has been used in cytometric bead array to measure the levels of interferon-γ in the sample.

It has also been used for cytokine treatment of human islets to evaluate the activation of hypoxia inducible factor 1 α (HIF1α) targets, in vitro.

Biochem/physiol Actions

IFN-γ is a dimerized soluble cytokine that is the only member of the type II class of interferons.Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses. IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells. This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity. In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.

General description

Recombinant human Interferon-γ (IFN-γ) is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 16 kDa. This protein is manufactured in human cells using an all-human production system, with full chemically defined ingredients and with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture. The bioactivity of IFN-γ expressed in human 293 cells is significantly higher compared to bacterially expressed IFN-γ.

Interferon-γ (IFN-γ) is a pleotropic cytokine, encoded by the gene mapped to human chromosome 12q15. It is a non-covalent homodimer with two identical 17kDa polypeptide chains. It belongs to the type II class of interferons.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

assay≥98% (SDS-PAGE)
formlyophilized powder
mol wt16 kDa (glycosylated)
potency≤0.250 ng/mL In Viral Resistance Assay ED50
Quality Level200
recombinantexpressed in HEK 293 cells
storage temp.−20°C
suitabilityendotoxin tested
technique(s)cell culture | mammalian: suitable
Pack100UG
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.