CD164 human, recombinant, expressed in E. coli, 0.5 mg protein/mL

Code: 5100-50UG D2-231

Not available outside of the UK & Ireland.

Application

Coating a plate well (6 well plate) with this recombinant CD164 matrix protein in HSC cell specific medium at 1-10 µg/well allows for human HSC / receptor in...


 Read more

Your Price
$300.16 50UG
Discontinued

Not available outside of the UK & Ireland.

Application

Coating a plate well (6 well plate) with this recombinant CD164 matrix protein in HSC cell specific medium at 1-10 µg/well allows for human HSC / receptor interaction studies in vitro.Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 µg/well, 6 well plate).Note: Use 1 ml PBS per well in a 6-well plate. 2. Add 1 - 10 µg protein to each well and incubate at 2 to 10 °C overnight. 3. After incubation, aspirate remaining material. 4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained

Preparation Note

The full-length extracellular domain of the human CD164 cDNA (24 - 162 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.

Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

accession no.NP_006007
assay≥90% (SDS-PAGE)
biological sourcehuman
concentration0.5 mg protein/mL
description0.05 mg of recombinant human CD164 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
formliquid
Gene Informationhuman ... CD164(8763)
packagingpkg of 50 µg
recombinantexpressed in E. coli
sterilityFiltered sterilized solution
storage temp.−20°C
UniProt accession no.Q04900
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.