MONOCLONAL ANTI-ATAXIN - FITC

Code: SAB5201368-100UG D2-231

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 Read more

Your Price
$697.33 100UG

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Immunogen

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Physical form

PBS pH 7.4, 50% glycerol, 0.1% sodium azide

antibody formpurified immunoglobulin
antibody product typeprimary antibodies
biological sourcemouse
cloneS76-8, monoclonal
concentration1 mg/mL
conjugateFITC conjugate
formbuffered aqueous solution
Gene Informationmouse ... Atxn1(20238)
isotypeIgG2b
mol wtantigen predicted mol wt 85 kDa
NCBI accession no.NP_001186233.1
Quality Level100
shipped inwet ice
species reactivityrat, mouse, human
storage temp.−20°C
technique(s)western blot: suitable, immunoprecipitation (IP): suitable, immunohistochemistry: suitable
UniProt accession no.P54253
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.