ANTI-ULK1 (N-TERMINAL) ANTIBODY PRODUCE

Code: SAB2109080-100UL D2-231

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 Read more

Your Price
$490.67 100UL

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ULK1 is a serine/threonine-protein kinase involved in autophagy in response to starvation. It acts upstream of phosphatidylinositol 3-kinase PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and negative regulator of mammalian target of rapamycin complex 1 (mTORC1) via interaction with RPTOR. It is activated via phosphorylation by AMPK and also acts as a regulator of AMPK by mediating phosphorylation of AMPK subunits PRKAA1, PRKAB2 and PRKAG1, leading to negatively regulate AMPK activity. It may phosphorylate ATG13/KIAA0652 and RPTOR; however such data need additional evidences and plays a role early in neuronal differentiation and is required for granule cell axon formation.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human ULK1

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ULK1(57396)
mol wt112 kDa
NCBI accession no.NM_003565
shipped inwet ice
species reactivity (predicted by homology)bovine, guinea pig, rabbit, horse, human, mouse, canine, rat
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.