ANTI-HBEGF (N-TERMINAL) ANTIBODY PRODUC

Code: SAB2109055-100UL D2-231

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 Read more

Your Price
$419.42 100UL

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

HBEGF is a growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. It is required for normal cardiac valve formation and normal heart function. HBEGF promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. It also acts as a diphtheria toxin receptor.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human HBEGF

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: FLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HBEGF(57396)
mol wt22 kDa
NCBI accession no.NM_001945
shipped inwet ice
species reactivity (predicted by homology)rat, pig, rabbit, canine, guinea pig, bovine, human, mouse
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.