ANTI-PAK6 (C-TERMINAL) ANTIBODY PRODUCED

Code: SAB2109009-100UL D2-231

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 Read more

Your Price
$493.36 100UL

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

This gene encodes a member of a family of p21-stimulated serine/threonine protein kinases, which contain an amino-terminal Cdc42/Rac interactive binding (CRIB) domain and a carboxyl-terminal kinase domain. These kinases function in a number of cellular processes, including cytoskeleton rearrangement, apoptosis, and the mitogen-activated protein (MAP) kinase signaling pathway. The protein encoded by this gene interacts with androgen receptor (AR) and translocates to the nucleus, where it is involved in transcriptional regulation. Changes in expression of this gene have been linked to prostate cancer. Alternative splicing results in multiple transcript variants.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human PAK6

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: LRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLYRKQTST

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PAK6(57396)
mol wt74 kDa
shipped inwet ice
species reactivity (predicted by homology)rabbit, canine, human, guinea pig, goat, horse, bovine, mouse
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.