ANTI-MLKL

Code: sab2108746-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Mixed lineage kinase domain-like protein (MLKL) primarily causes receptor-interacting protein (RIP) kinase–dependent necroptosis. However, durin...


 En savoir plus

Votre prix
$459.05 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Mixed lineage kinase domain-like protein (MLKL) primarily causes receptor-interacting protein (RIP) kinase–dependent necroptosis. However, during hepatitis, it results in programmed hepatocellular necrosis which is independent of RIPK3.s MLKL also participates in endosomal trafficking and in the formation of extracellular vesicles.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Mixed lineage kinase domain-like protein (MLKL) is encoded by the gene mapped to human chromosome 16q23. Activated MLKL is localized on the cell membrane.

Immunogen

Synthetic peptide directed towards the N terminal region of human MLKL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE

accession no.NM_152649
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MLKL(197259)
mol wt54 kDa
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.Q8NB16
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.