Not available outside of the UK & Ireland.
Biochem/physiol Actions
Free fatty acid receptor 1 (FFAR1) is activated by binding of medium or long chain free fatty acids. It increases the Ca2+ level intracellularly through phospholipase C mediated signalling and that potentially stimulates insulin production. FFAR1 is a potential drug target for metabolic diseases like type 2 diabetes.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Free fatty acid receptor 1 (FFAR1) formerly known as G-protein coupled receptor 40 (GPR 40) is predominantly expressed in pancreatic beta cells. In human chromosome, the gene FFAR1 is located on 19q13.12.
Immunogen
Synthetic peptide directed towards the N terminal region of human FFAR1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV
This product has met the following criteria to qualify for the following awards: