ANTI-FFAR1

Code: SAB2108661-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Free fatty acid receptor 1 (FFAR1) is activated by binding of medium or long chain free fatty acids. It increases the Ca2+ level intracellu...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Free fatty acid receptor 1 (FFAR1) is activated by binding of medium or long chain free fatty acids. It increases the Ca2+ level intracellularly through phospholipase C mediated signalling and that potentially stimulates insulin production. FFAR1 is a potential drug target for metabolic diseases like type 2 diabetes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Free fatty acid receptor 1 (FFAR1) formerly known as G-protein coupled receptor 40 (GPR 40) is predominantly expressed in pancreatic beta cells. In human chromosome, the gene FFAR1 is located on 19q13.12.

Immunogen

Synthetic peptide directed towards the N terminal region of human FFAR1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV

accession no.NM_005303
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FFAR1(2864)
mol wt31 kDa
Quality Level100
shipped inwet ice
species reactivityhuman, bovine, dog
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.O14842
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.