Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
CHAT is an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This protein is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer disease. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
The immunogen for Anti-CHAT antibody: synthetic peptide directed towards the C terminal of human CHAT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPS
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :