ANTI-FOXP3

Code: SAB2108477-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumabl...


 Read more

Your Price
$380.97 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human FOXP3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL

accession no.NM_014009
antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FOXP3(50943)
mol wt47 kDa
Quality Level100
shipped inwet ice
species reactivitypig, human, sheep, bovine
storage temp.−20°C
technique(s)immunoblotting: suitable, immunohistochemistry: suitable
UniProt accession no.Q9BZS1
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.