ANTI-FOXA3

Code: SAB2108468-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Forkhead box A3 (FOXA3) plays a vital role in maintenance of cell glucose homeostasis during prolonged fast. It is also implicated in the regulation o...


 Read more

Your Price
$610.31 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Forkhead box A3 (FOXA3) plays a vital role in maintenance of cell glucose homeostasis during prolonged fast. It is also implicated in the regulation of fat mass in humans. FOXA3 inhibits innate immunity and increases the risk of susceptibility to viral infections associated with chronic lung disorders accompanied by chronic goblet cell metaplasia.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Forkhead box A3 (FOXA3), also known as hepatocyte nuclear factor 3 γ (HNF3γ), is encoded by the gene mapped to human chromosome 19q13.32. The encoded protein belongs to the Foxa subfamily. FOXA3 is characterized with a homologous forkhead DNA-binding domain and two transcriptional activation domains located at the N- and C-terminal.

Immunogen

Synthetic peptide directed towards the middle region of human FOXA3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP

accession no.NM_004497
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FOXA3(3171)
mol wt37 kDa
Quality Level100
shipped inwet ice
species reactivityguinea pig, bovine, rat, dog, human
storage temp.−20°C
technique(s)immunoblotting: suitable, immunohistochemistry: suitable
UniProt accession no.P55318
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.