Not available outside of the UK & Ireland.
Biochem/physiol Actions
Forkhead box A3 (FOXA3) plays a vital role in maintenance of cell glucose homeostasis during prolonged fast. It is also implicated in the regulation of fat mass in humans. FOXA3 inhibits innate immunity and increases the risk of susceptibility to viral infections associated with chronic lung disorders accompanied by chronic goblet cell metaplasia.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Forkhead box A3 (FOXA3), also known as hepatocyte nuclear factor 3 γ (HNF3γ), is encoded by the gene mapped to human chromosome 19q13.32. The encoded protein belongs to the Foxa subfamily. FOXA3 is characterized with a homologous forkhead DNA-binding domain and two transcriptional activation domains located at the N- and C-terminal.
Immunogen
Synthetic peptide directed towards the middle region of human FOXA3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
This product has met the following criteria to qualify for the following awards: