ANTI-NNMT

Code: SAB2108008-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity wh...


 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human NNMT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NNMT(4837)
mol wt29kDa
NCBI accession no.NM_006169
Quality Level100
shipped inwet ice
species reactivityhuman, rat, mouse
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.P40261
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.