ANTI-FOXO6

Code: SAB2107945-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Murine Foxo6 is a member of the murine forkhead family of transcription factors. This family consists of over 30 members, the vast majority of which i...


 Read more

Your Price
$455.72 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Murine Foxo6 is a member of the murine forkhead family of transcription factors. This family consists of over 30 members, the vast majority of which is important in embryonic development. These forkhead transcription factors may play a role in maintenance and survival of developing and adult neurons.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal of human FOXO6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGAPVPGPLS

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationmouse ... FOXO6(329934)
mol wt61kDa
NCBI accession no.NM_194060
Quality Level100
shipped inwet ice
species reactivityrat, mouse, human
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.Q70KY4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.