Not available outside of the UK & Ireland.
Application
Anti-DNASE1L3 antibody produced in rabbit is suitable for western blot and indirect ELISA.
Biochem/physiol Actions
DNASE1L3 (Deoxyribonuclease I-like 3) is involved in residual nuclease activity of internucleosomal chromatin. In presence of Ca2+/Mg2+, it produces 3′-OH/5′-P ends by cleaving both the DNA strand, double-stranded and single-stranded DNA molecule. It has also been reported that DNASE1L3 may cleave apoptotic DNA of thymocytes, neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease. Mutation in DNASE1L3 causes a rare syndrome, hypocomplementemic urticarial vasculitis syndrome (HUVS).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
DNASE1L3 (Deoxyribonuclease I-like 3) is a 32kDa endonuclease protein expressed in the spleen, liver, thymus, lymph node, bone marrow, small intestine and kidney. It consists of an N-terminal signal peptide responsible for the rER (rough endoplasmic reticulum) transport.
Immunogen
The immunogen for anti-DNASE1L3 antibody: synthetic peptide derected towards the C terminal of human DNASE1L3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
This product has met the following criteria to qualify for the following awards: