Anti-SNX10

Code: SAB2107086-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Snx10 may be involved in several stages of intracellular trafficking. May play a role in endosome homeostasis. Overexpression causes formation of huge...


 Read more

Your Price
$599.56 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Snx10 may be involved in several stages of intracellular trafficking. May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles. Mutations in SNX10 leads to autosomal recessive osteoporosis due to dysregulation of osteoclasts. SNX10 interaction with vacuolar-type H+ -ATPase (V-ATPase) complex initiates ciliogenesis, critical for early embryonic development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Sorting nexin 10 (SNX10) is a transmembrane protein belonging to SNX family. SNX10 has phox domain which binds to phosphoinositide-binding domain. In human chromosome, the gene SNX10 is located on 7p15.2.

Immunogen

The immunogen for anti-SNX10 antibody: synthetic peptide derected towards the middle region of human SNX10

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SNX10(29887)mouse ... Snx10(71982)
mol wt22 kDa
NCBI accession no.NM_001127348
Quality Level100
shipped inwet ice
species reactivitypig, horse, bovine, rat, human, mouse, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9CWT3
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.