Anti-PORCN

Code: SAB2106860-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Porcn modulates the processing of Wnt proteins. Probable protein-cysteine N-palmitoyltransferase that palmitoylates Wnt family members.

...


 Read more

Your Price
$600.18 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Porcn modulates the processing of Wnt proteins. Probable protein-cysteine N-palmitoyltransferase that palmitoylates Wnt family members.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-PORCN antibody: synthetic peptide derected towards the middle region of human PORCN

Sequence

Synthetic peptide located within the following region: VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
Gene Informationhuman ... PORCN(64840)mouse ... Porcn(53627)
mol wt51 kDa
NCBI accession no.NM_016913
packagingpkg of 50 µg lyophilized powder, pkg of 100 µL buffered aqueous solution
Quality Level100
species reactivityguinea pig, human, rat, bovine, mouse, rabbit, horse, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9JJJ7-4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.