Anti-NDUFB8

Code: SAB2106740-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Ndufb8 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in ...


 Read more

Your Price
$509.49 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Ndufb8 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-NDUFB8 antibody: synthetic peptide derected towards the C terminal of human NDUFB8

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NDUFB8(4714)mouse ... Ndufb8(67264)
mol wt22 kDa
NCBI accession no.NM_026061
Quality Level100
shipped inwet ice
species reactivitydog, horse, human, bovine, goat, rabbit, guinea pig, mouse, sheep, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9D6J5
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.