Anti-IGHMBP2

Code: SAB2106426-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Ighmbp2 is a 5′ to 3′ helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. ...


 Read more

Your Price
$600.41 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Ighmbp2 is a 5′ to 3′ helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5′-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5′-GGGCT-3′ motif. Ighmbp2 interacts with tRNA-Tyr.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal of human IGHMBP2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... IGHMBP2(3508)mouse ... Ighmbp2(20589)
mol wt109 kDa
NCBI accession no.NM_009212
Quality Level100
shipped inwet ice
species reactivitymouse, dog, bovine, guinea pig, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P40694
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.