Anti-SPNS2

Code: SAB2104271-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-SPNS2, (N-terminal) antibody produced in rabbit has been used in immunoblotting (1:1000)/(1:3,000).

Biochem/physiol Actions

The ...


 Read more

Your Price
$612.52 100UL

Not available outside of the UK & Ireland.

Application

Anti-SPNS2, (N-terminal) antibody produced in rabbit has been used in immunoblotting (1:1000)/(1:3,000).

Biochem/physiol Actions

The sphingolipid transporter 2/Spinster 2 (SPNS2) protein serves as a mediator to release intracellular sphingosine-1-phosphate (S1P) and thereby regulates S1P. It might play a role in embryogenesis. Members of MFS family regulates the homeostasis in the body by transporting sugars, amino acids, ions, intermediary metabolites, and other small molecules across membranes. Lack of SPNS2 results in a significant reduction in S1P plasma levels. It plays an important role in prostate cancer, inflammatory and autoimmune diseases, and liver fibrosis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The sphingolipid transporter 2/Spinster 2 (SPNS2) gene codes for a transporter of the sphingosine-1-phosphate (S1P) signaling lipid. SPNS2 is a multi-pass transmembrane protein, that belongs to the spinster (SPNS)/major facilitator superfamily (MFS) family. It has 12 transmembrane domains. SPNS2 mRNA is seen abundantly in the lung, stomach, and placenta. It is expressed at a moderate level in the cervix, small intestine, brain, skin,lymph node, and other tissues.

Immunogen

Synthetic peptide directed towards the N terminal region of human SPNS2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SPNS2(124976)
mol wt60 kDa
NCBI accession no.NM_001124758
Quality Level100
shipped inwet ice
species reactivitypig, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8IVW8
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.