Anti-MARCH5

Code: SAB2103803-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

MARCH5 is an ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

MARCH5 is an ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2) and DRP1 (DNM1L). MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1502 AK000452.1 3-1504 1503-1863 BC015480.1 1463-1823 1864-1901 BE393612.1 438-475 1902-3713 BC015480.1 1852-3663 3714-3941 BC015480.1 3669-3896

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human MARCH5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
clonepolyclonal
concentration0.5 mg - 1 mg/mL
formbuffered aqueous solution
Gene Informationhuman ... MARCH5(54708)
mol wt31 kDa
NCBI accession no.NM_017824
Quality Level100
shipped inwet ice
species reactivityrabbit, horse, mouse, bovine, human, guinea pig, dog, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NX47
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.