Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Western Blotting (1 paper)
Biochem/physiol Actions
SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human SLC19A3
Sequence
Synthetic peptide located within the following region: FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :