Anti-SLC19A3

Code: SAB2103795-100UL D2-231

Not available outside of the UK & Ireland.

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Western Blotting (1 paper)

...


 Read more

Your Price
$458.41 100UL

Not available outside of the UK & Ireland.

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Western Blotting (1 paper)

Biochem/physiol Actions

SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human SLC19A3

Sequence

Synthetic peptide located within the following region: FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC19A3(80704)
mol wt56 kDa
NCBI accession no.NM_025243
Quality Level100
shipped inwet ice
species reactivitymouse, guinea pig, rat, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9BZV2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.