Not available outside of the UK & Ireland.
Application
Anti-AQP10 antibody may be used in western blot.
Biochem/physiol Actions
AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea. This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human AQP10
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
This product has met the following criteria to qualify for the following awards: