Not available outside of the UK & Ireland.
Biochem/physiol Actions
Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-291 BM855386.1 13-303 292-719 BM920315.1 256-683 720-1015 BC031562.1 662-957 1016-1231 BG747063.1 249-464 1232-1241 AA844782.1 59-68 c 1242-1301 BC042420.1 1208-1267
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human AKR7A3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
This product has met the following criteria to qualify for the following awards: