Anti-VGF

Code: SAB2102676-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

VGF is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. It also shares similarities with ...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

VGF is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. It also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human VGF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... VGF(7425)
mol wt65 kDa
Quality Level100
shipped inwet ice
species reactivityhuman, rat, guinea pig, dog, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O15240
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.