Anti-TTYH1

Code: SAB2102600-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-TTYH1 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

TTYH1 is a member of the tweety fam...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-TTYH1 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TTYH1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TTYH1(57348)
mol wt49 kDa
Quality Level100
shipped inwet ice
species reactivitydog, bovine, guinea pig, human, rabbit, mouse, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9H313
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.