Anti-TMEM173

Code: SAB2102463-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

TMEM173 acts as a facilitator of innate immune signaling. It is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression ...


 Read more

Your Price
$458.41 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

TMEM173 acts as a facilitator of innate immune signaling. It is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. TMEM173 may be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons.It also may be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). TMEM173 mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TMEM173

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TMEM173(340061)
mol wt42 kDa
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q86WV6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.