Anti-IMPDH1

Code: SAB2101156-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5R...


 Read more

Your Price
$517.56 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5′-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human IMPDH1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... IMPDH1(3614)
mol wt62 kDa
Quality Level100
shipped inwet ice
species reactivitybovine, dog, mouse, human, horse, rat, guinea pig, rabbit
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P20839
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.