Not available outside of the UK & Ireland.
Application
Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot
Immunocytochemistry
Immunohistochemistry (Frozen Sections)
Optimal working dilutions must be determined by the end user.
General description
MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.
Immunogen
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY
Legal Information
CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Physical form
Purified. Liquid in PBS containing 0.01% sodium azide.
Format: Purified
Specificity
Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.
SPECIES REACTIVITIES:
Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
This product has met the following criteria to qualify for the following awards: