Not available outside of the UK & Ireland.
Application
Anti-ISYNA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Western Blotting (1 paper)
Biochem/physiol Actions
ISYNA1 (inositol-3-phosphate synthase 1) gene encodes a protein that belongs to myo-inositol 1-phosphate synthase family and is predominantly expressed in testis, ovary, heart, placenta and pancreas. It is a crucial enzyme in myo-inositol biosynthesis pathway that plays a pivotal role in catalyzing the rate-limiting conversion of glucose 6-phosphate to myoinositol 1-phosphate.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human ISYNA1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD
This product has met the following criteria to qualify for the following awards: