Not available outside of the UK & Ireland.
Application
Anti-HSPA4L antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/mL.
Biochem/physiol Actions
Hspa4l is expressed ubiquitously and predominantly in the testis and is highly expressed in spermatogenic cells. It plays an important role in osmotolerance. HSPA4L and HSPA4 collaborate in embryonic lung maturation and helps in air breathing during child birth. Osp94 also acts as molecular chaperone and possesses cytoprotective role from excessive stimulation from heat, hyper-ionic and osmotic stress which cause marked perturbation of intracellular protein function including the suppression of protein synthesis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Heat shock 70kDa protein 4L is a protein encoded by the HSPA4L gene in humans. Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones.
Immunogen
Synthetic peptide directed towards the C terminal region of human HSPA4L
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
This product has met the following criteria to qualify for the following awards: