Anti-COX3

Code: AV50251-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-COX3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

C...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-COX3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Cytochrome oxidases make up the terminal complex of the electron transport chain in the mitochondria. Deletions in mitochondrially encoded cytochrome c oxidase III (MT-CO3; COX3) gene are associated with rhabdomyolysis. Mutation in COX3 is linked to maternally inherited diabetes and deafness associated with nephropathy. COX3 mutations have been observed in asthenozoospermic infertile men, patients with MELAS (mitochondrial encephalomyopathy, lactic acidosis and stroke-like episodes) and Leber hereditary optic neuropathy. Hepatitis B virus X protein interacts with COX3 and the intercation might be crucial for hepatocarcinoma tumorigenesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Mitochondrially encoded cytochrome c oxidase III (MT-CO3; COX3) is encoded by the mitochondrial DNA and localizes to the inner mitochondrial membrane. COX3 is generally mentioned as COXIII.

Immunogen

Synthetic peptide directed towards the C terminal region of human COX3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MTCO3(4514)
mol wt29 kDa
NCBI accession no.NP_536849
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.