Anti-LENG4

Code: AV49811-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-LENG4 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml. The antibody has been used for western blotting for protei...


 Read more

Your Price
$537.72 100UL

Not available outside of the UK & Ireland.

Application

Anti-LENG4 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml. The antibody has been used for western blotting for proteins isolated from mice brain tissue.

Biochem/physiol Actions

Membrane bound O-acyltransferase domain containing 7 (MBOAT7; LENG4) is an integral membrane protein important for reacylation of phospholipids. The reacylation is an important step in the recycling of phospholipids via the Land cycle. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. LENG4 interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Membrane bound O-acyltransferase domain containing 7 (MBOAT7; LENG4; LPLAT7) belongs to membrane-bound O-acyltransferase (MBOAT) family. The protein shows an endoplasmic reticulum-like reticular pattern and perinuclear staining in HEK293 cells.

Immunogen

Synthetic peptide directed towards the C terminal region of human LENG4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LENG4(79143)
mol wt53 kDa
NCBI accession no.NP_077274
Quality Level100
shipped inwet ice
species reactivitydog, human, horse, pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q96N66
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.