Anti-SEMA6D

Code: AV49583-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-SEMA6D antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-SEMA6D antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

Semaphorins are transmembrane and secreted proteins involved in immune responses, activation of immune cells and axon guidance during neuronal development. SEMA6D regulates the late phase of primary immune responses by the CD4+ T cells. The function and expression of SEMA6D is important during the development of mammalian retinal circuit.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SEMA6D

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SEMA6D(80031)
mol wt52 kDa
NCBI accession no.NP_065909
Quality Level100
shipped inwet ice
species reactivitybovine, dog, human, rat, rabbit, horse, guinea pig, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8NFY4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.