Anti-IL22

Code: av49523-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-IL22 antibody produced in rabbit has been used in immunoblotting (1:1000).

Biochem/physiol Actions

Interleukin 22 (IL22) belongs...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-IL22 antibody produced in rabbit has been used in immunoblotting (1:1000).

Biochem/physiol Actions

Interleukin 22 (IL22) belongs to the interleukin 10 (IL-10) family. It is a cytokine that contributes to the inflammatory response in vivo. IL22 cellular effects are mediated by a heterodimeric receptor made up of IL22 and IL-10Rβ. IL22 signaling mediates proliferation of epithelial cells during inflammation mainly by the activation of signal transducer and activator of transcription 1 (STAT1) and STAT3 signaling.

Interleukin 22 (IL-22) plays a key role in cell proliferation, cellular defense, and tissue regeneration, It shows potential in wound healing and to treat gastrointestinal (GI)-related illnesses. Higher levels of IL-22 is observed in systemic lupus erythematosus, vitiligo, multiple sclerosis, etc.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Interleukin 22 (IL-22) belongs to the IL10 family of T-cell associated cytokines, highly expressed in αβ and γδ T cells, as well as in innate lymphoid cells. Inflammatory cells associated with the thymus, pancreas, synovium, skin, and gut secrete IL-22. The Il-22 gene is localized on human chromosome 12q15.

Immunogen

Synthetic peptide directed towards the C terminal region of human IL22

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... IL22(50616)
mol wt20 kDa
NCBI accession no.NP_065386
Quality Level100
shipped inwet ice
species reactivitymouse, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9GZX6
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.