Anti-PLXDC1

Code: AV49500-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-PLXDC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Application

Anti-PLXDC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Plexin domain containing 1 (PLXDC1; tumor endothelial marker 7, TEM7) is a transmembrane and secreted protein containing plexin-like and weak nidogen-like domains. It mediates protein-protein interactions and is associated with angiogenic state of these cells. It is highly expressed in endothelium of tumor cells in a variety of cancer types.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human PLXDC1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PLXDC1(57125)
mol wt54 kDa
NCBI accession no.NP_065138
Quality Level100
shipped inwet ice
species reactivitydog, mouse, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8IUK5
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.