Anti-MAP3K2

Code: AV49223-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-MAP3K2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions


 Read more

Your Price
$462.90 100UL

Not available outside of the UK & Ireland.

Application

Anti-MAP3K2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

MAP Kinase Kinase Kinase 2 (MAP3K2; MEKK2) belongs to a family of enzymes that activates their substrate by dual phosphorylation at serine and threonine residues. MAP3K2 activates the kinases involved in the MAPK signaling pathway. It activates Iκ B kinases that are important regulators of NF-κB pathway. This kinase also facilitates cross-talk between c- Jun and FAK and MAPK and activates several downstream targets that contribute to cell proliferation, inflammation apoptosis and motility.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human MAP3K2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MAP3K2(10746)
mol wt70 kDa
NCBI accession no.NP_006600
Quality Level100
shipped inwet ice
species reactivitydog, human, bovine, pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9Y2U5
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.