Anti-LYK5

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-LYK5 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

LYK5 is also known as STE20-related kinase adaptor alpha (STRADA) is a pseudokinase that activates STK11 and prevents it from entering the nucleus. It has a regulatory role in STK11-mediated cell cycle arrest in G1 phase. Mutations in gene encoding LYK5 are associated with PMSE syndrome (polyhydramnios, megalencephaly and symptomatic epilepsy).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human LYK5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV