Anti-SEP15

Code: AV48247-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SEP15 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

SEP15...


 Read more

Your Price
$517.56 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SEP15 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

SEP15 is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. The gene that encodes the protein is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3′ UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. This gene is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SEP15 is a selenoprotein that regulates the unfolded protein response. It is modulated by ER stresses. SEP15 variations have been linked to the risk of lung cancer.Rabbit Anti-SEP15 antibody recognizes bovine, zebrafish, pig, human, mouse, rat, and canine SEP15.

Immunogen

Synthetic peptide directed towards the middle region of human SEP15

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SEP15(9403)
mol wt15 kDa
NCBI accession no.NP_004252
Quality Level100
shipped inwet ice
species reactivityhuman, mouse, pig, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O60613
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.