Anti-SLC14A1

Code: AV48116-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SLC14A1 antibody is suitable for western blot applications at a concentration of western blot at a concentration of 0.25 µg/ml and for IHC at 4-8...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SLC14A1 antibody is suitable for western blot applications at a concentration of western blot at a concentration of 0.25 µg/ml and for IHC at 4-8 µg/ml.

Biochem/physiol Actions

SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SLC14A1 codes for a protein that belongs to the solute carrier family. It facilitates the transport of urea in red blood cells and also forms the basis of the Kidd blood grouping system. SLC14A1 has been identified as a susceptibility locus for bladder cancer.Rabbit Anti-SLC14A1 antibody recognizes human, canine, bovine, and mouse SLC14A1.

Immunogen

Synthetic peptide directed towards the C terminal region of human SLC14A1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC14A1(6563)
mol wt42 kDa
NCBI accession no.NP_001122060
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q13336
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.