Anti-SERPINE1

Code: av47470-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-SerPINE1 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml.

Biochem/physiol Actions


 En savoir plus

Votre prix
$557.33 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-SerPINE1 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

SERPINE1 acts as ′bait′ for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SerPINE1 is a serine proteinase inhibitor that blocks fibrinolys by inhibiting tissue plasminogen activator (tPA) and urokinase (uPA). Genetic variations in SERPINE1 have been linked to pre-eclampsia (PE). Studies have reported that targeting SERPINE1 (PAI-1) expression in Alzheimer′s disease may have therapeutic implications. Moreover, MiR-34c regulates SERPINE1 expression in emphysema.Rabbit Anti-SerPINE1 antibody recognizes human, mouse, rat, zebrafish, bovine, pig, chicken, and canine SERPINE1.

Immunogen

Synthetic peptide directed towards the C terminal region of human SERPINE1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SERPINE1(5054)
mol wt43 kDa
NCBI accession no.NP_000593
Quality Level100
shipped inwet ice
species reactivityrat, pig, bovine, human, horse, sheep, dog, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P05121
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.