Anti-ST3GAL2

Code: AV46800-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-ST3GAL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

...


 Read more

Your Price
$511.01 100UL

Not available outside of the UK & Ireland.

Application

Anti-ST3GAL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) gene encodes a type II membrane protein that belongs to the glycosyltransferase family 29. It plays a pivotal role in transfering the sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL2 is a MSGb5 (stage-specific embryonic antigen-4) synthase and increased expression of ST3Gal II facilitates as a marker for renal carcinogenesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human ST3GAL2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ST3GAL2(6483)
mol wt40 kDa
NCBI accession no.NP_008858
Quality Level100
shipped inwet ice
species reactivitydog, guinea pig, rat, mouse, bovine, horse, rabbit, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q16842
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.