Anti-SC4MOL

Code: AV46773-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-SC4MOL polyclonal antibody is used to tag sterol-C4-methyloxidase-like for detection and quantitation by Western blotting and in plasma by immunohistochemica...


 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Application

Anti-SC4MOL polyclonal antibody is used to tag sterol-C4-methyloxidase-like for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of sterol-C4-methyloxidase-like in the management of C4-methlysterols (meiosis-activating sterols, MAS) levels.

Biochem/physiol Actions

Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Sterol-C4-methyloxidase-like/methylsterol monooxygenase 1 (SC4MOL, DESP4, ERG25, MSMO1) is an endoplasmic reticulum enzyme that catalyzes the demethylation of C4-methlysterols (meiosis-activating sterols, MAS) in the cholesterol synthesis pathway. Defective/mutated SC4MOL contributes to psoriasiform dermatitis, microcephaly, and developmental delay.

Immunogen

Synthetic peptide directed towards the N terminal region of human SC4MOL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA

Specificity

Anti-SC4MOL polyclonal antibody reacts with zebrafish, bovine, pig, human, mouse, rat, and canine sterol-C4-methyloxidase-like proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SC4MOL(6307)
mol wt35 kDa
NCBI accession no.NP_006736
Quality Level100
shipped inwet ice
species reactivityhuman, horse, dog, pig, rabbit, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q15800
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.