Not available outside of the UK & Ireland.
Application
Anti-CDT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/ml.
Biochem/physiol Actions
CDT1 (chromatin licensing and DNA replication factor 1) gene also referred to as DUP or RIS2 encodes for a protein that is a nuclear localizing replication initiation factor and is expressed only during the G1 and S phases of the cell cycle. CDT1 interacts with CDC6 and stimulates the loading of the mini-chromosome maintenance complex onto chromatin. Hence it forms a pre-replication complex necessary to initiate DNA replication. Further, geminin inhibits CDT1 and may facilitate the inhibition of replication at inappropriate origins. Overexpression of Cdt1 mRNA and geminin may play a crucial role in pathogenesis of acute leukemia (AL).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human CDT1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ
This product has met the following criteria to qualify for the following awards: