Anti-SHMT2

Code: AV46128-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-SHMT2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml and for immunohistochemistry at a concentration ...


 Read more

Your Price
$402.51 100UL

Not available outside of the UK & Ireland.

Application

Anti-SHMT2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml and for immunohistochemistry at a concentration of 4-8µg/ml.

Biochem/physiol Actions

SHMT2 gene encodes an enzyme serine hydroxymethyltransferase 2 (mitochondrial), which is a pyridoxal phosphate-dependent enzyme that regulates the biosynthesis of thymidylate in mammals. It catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. Additionally, it facilitates the interconversion of serine and glycine and is associated with mitochondrial DNA which assists in preventing the uracil accumulation in mtDNA.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SHMT2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SHMT2(6472)
mol wt56 kDa
NCBI accession no.NP_005403
Quality Level100
shipped inwet ice
species reactivitybovine, rat, horse, guinea pig, mouse, rabbit, human, dog
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P34897
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.